Detailed Information
Basic Information (Experimental Results)
| AcrHub ID | Acr00065 |
| Name | anti_CRISPR0001 (anti-CRISPRdb);;Chain I, Anti-crispr Protein Acrf1 (NCBI);;anti-CRISPR protein AcrF1 (NCBI);;Chain A, ACR30-35 (NCBI) |
| Gene Name | JBD30_035 |
| Family | AcrIF1 |
| Inhibited CRISPR Type(s) | I-F |
| Inhibited Stage |
DNA Binding 
|
| Molecular Mechanism |
Interact with the hexameric Cas7f spine of the cascade (block DNA binding)
|
| Targeted Protein |
Cas7f
|
| Cellular Context |
Pseudomonas aeruginosa PA14
|
| Source Of Species | Pseudomonas phage JBD30 |
| Function | The protein inhibits the Type I-F CRISPR-Cas system in Pseudomonas aeruginosa with high efficiency. |
| Sequence | MKFIKYLSTAHLNYMNIAVYENGSKIKARVENVVNGKSVGARDFDSTEQLESWFYGLPGSGLGRIENAMNEISRRENP |
| Length | 78 amino acids |
| UniProt ID | L7P7M1 |
| PubMed ID | 23242138 |
Protein Structure (Experimental Results)
| PDB Accession | Method | Resolution | Chain | Positions | Structure Review |
|---|---|---|---|---|---|
| 5XLO | Electron microscopy | 3.80 A | M/N | 1-78 | 5XLO |
| 6B46 | Electron microscopy | 3.10 A | I/J | 1-78 | 6B46 |
| 5XLP | Electron microscopy | 4.20 A | M | 1-78 | 5XLP |
| 5UZ9 | Electron microscopy | 3.40 A | I/J | 2-78 | 5UZ9 |
| 2LW5 | NMR | A | 1-78 | 2LW5 | |
| 6ANV | X-ray | 2.27 A | A/B | 1-78 | 6ANV |