Detailed Information
Basic Information (Experimental Results)
AcrHub ID | Acr00056 |
Name | anti_CRISPR0407 (anti-CRISPRdb);;Chain A, NHis AcrE1 anti-crispr protein (NCBI);;anti-CRISPR protein AcrE1 (NCBI) |
Gene Name | JBD5_034 ACR5-34 |
Family | AcrIE1 |
Inhibited CRISPR Type(s) | I-E |
Inhibited Stage |
DNA Cleavage ![]() |
Molecular Mechanism |
Bind as a dimer to Cas3 (block DNA cleavage) ![]() |
Targeted Protein |
Cas3 ![]() |
Cellular Context |
Pseudomonas aeruginosa SMC4386 ![]() |
Source Of Species | Pseudomonas phage JBD5 |
Function | The protein inhibits the type I-E CRISPR-Cas system of Pseudomonas aeruginosa. |
Sequence | MEKKLSDAQVALVAAWRKYPDLRESLEEAASILSLIVFQAETLSDQANELANYIRRQGLEEAEGACRNIDIMRAKWVEVCGEVNQHGIRVYGDAIDRDVD |
Length | 100 amino acids |
UniProt ID | L7P7L6 |
PubMed ID | 24736222 |
Protein Structure (Experimental Results)
PDB Accession | Method | Resolution | Chain | Positions | Structure Review |
---|---|---|---|---|---|
6AS4 | X-ray | 2.00 A | A/B/C | 1-100 | 6AS4 |
6AS3 | X-ray | 2.00 A | A/B/C/D | 1-100 | 6AS3 |
6ARZ | X-ray | 2.50 A | A/B/C | 2-100 | 6ARZ |